PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000742771
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 482aa    MW: 52926.1 Da    PI: 6.5076
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000742771genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.4e-17107154148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++l+ +++++G g+W++ + + g+ R++k+c++rw +yl
    MDP0000742771 107 KGPWTPEEDQKLLAYIEEHGHGSWRALPTKAGLQRCGKSCRLRWTNYL 154
                      79********************************************97 PP

2Myb_DNA-binding52.51.2e-16160205148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
    MDP0000742771 160 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 205
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-2598157IPR009057Homeodomain-like
PROSITE profilePS5129418.015102154IPR017930Myb domain
SuperFamilySSF466892.47E-30104201IPR009057Homeodomain-like
SMARTSM007174.0E-14106156IPR001005SANT/Myb domain
PfamPF002492.4E-16107154IPR001005SANT/Myb domain
CDDcd001671.60E-11109154No hitNo description
PROSITE profilePS5129425.891155209IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-26158209IPR009057Homeodomain-like
SMARTSM007171.2E-16159207IPR001005SANT/Myb domain
PfamPF002496.2E-16160205IPR001005SANT/Myb domain
CDDcd001671.00E-11162205No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MGSVILDPNI DEICYLTING EPFMFNLXTK ISSRMDDKII KEEFTRTASH IRSSLYRSPS  60
PFTTFECTSF GRATFGPGSV MASDPLTHTT NILMGRSPCC DKVGLKKGPW TPEEDQKLLA  120
YIEEHGHGSW RALPTKAGLQ RCGKSCRLRW TNYLRPDIKR GKFSLQEEQT IIQLHALLGN  180
RWSAIATHLP KRTDNEIKNY WNTHLKKRLA KMGIDPVTHK PKNDALLXSA DGHSKNVSNL  240
SHMAQWESAR LEAEARLVRE SKLRSHSSSL LHQLTTTNPN TYVLVNSSSS GSTSAQLQIK  300
WPSSNPSNNN IDLESSTSTL NYNSDQTNVN NASSSAVGSA IMKPAMIEFV GCSXSSETKE  360
ECGDKEDWKS HLSFTSLGLV HDHQTITMSM DAGSAWPTAT DHQVGYVAAD MAAADQEGFT  420
NLLLNNSDEV QSLSDGDHGG DSDNGGGSGS GSGSDYYEDN KHYWNSILNL VNSSPSESPL  480
F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-271052095108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.119390.0bud| fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008341595.10.0PREDICTED: transcription factor MYB34-like
TrEMBLM5WYQ50.0M5WYQ5_PRUPE; Uncharacterized protein
STRINGPOPTR_0017s12230.11e-148(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-118myb domain protein 16